|
|
|
|
|
|
|
| Information on 1dw9_A_119 |
|
Loop code: 1dw9_A_119 PDB: 1dw9 Chain: A Type: HA beta-beta hairpin |
Loop Start: 119 Loop Length: 5 Sec Struct Nt length: 16 Sec Struct Ct length: 13 Structure geometry
|
| Sequence: | GIISAINFKLDVKKVADPEGGERAVITLDGKYLP |
| Sec Struct: | EEEEEEEEEEEEEEEE-TTSSEEEEEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | I - 121 | 1 | 0 |
| MSESELENOMETHIONINE | S - 122 | 1 | 0 |
| MSESELENOMETHIONINE | A - 123 | 1 | 0 |
| MSESELENOMETHIONINE | F - 126 | 1 | 0 |
| MSESELENOMETHIONINE | L - 128 | 1 | 0 |
| MSESELENOMETHIONINE | I - 144 | 1 | 0 |
| MSESELENOMETHIONINE | L - 146 | 1 | 0 |
| MSESELENOMETHIONINE | G - 148 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AS1 - CHLORIDE IONS K19 K23 RESIDUES SER122A, ARG96D, ARG96I, SER122J | S - 122 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|