|
|
|
|
|
|
|
| Information on 1a9x_A_355 |
|
Loop code: 1a9x_A_355 PDB: 1a9x Chain: A Type: HA beta-beta hairpin |
Loop Start: 355 Loop Length: 20 Sec Struct Nt length: 7 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | VVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIG |
| Sec Struct: | EEEEEEE--GGG-TTS--B--SS----EEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ADPADENOSINE-5'-DIPHOSPHATE | T - 376 | 0 | 1 |
| PO4PHOSPHATE ION | M - 378 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|