|
|
|
|
|
|
|
| Information on 1izo_A_384 |
|
Loop code: 1izo_A_384 PDB: 1izo Chain: A Type: HA beta-beta hairpin |
Loop Start: 384 Loop Length: 21 Sec Struct Nt length: 4 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | IEYDVPEQSLHYSLARMPSLPESGFVMSGIRR |
| Sec Struct: | EEEE--S------SSSSS---TT--EEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PAMPALMITOLEIC ACID | M - 400 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|