|
|
|
|
|
|
|
| Information on 1jz7_A_982 |
|
Loop code: 1jz7_A_982 PDB: 1jz7 Chain: A Type: AR beta-beta link |
Loop Start: 982 Loop Length: 22 Sec Struct Nt length: 9 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | TWLNIDGFHMGIGGDDSWSPSVSAEFQLSAGRYHYQLVWC |
| Sec Struct: | EEEEEEEEE-----S-SSS----GGGS---SEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GALD-GALACTOSE | W - 999 | 0 | 1 |
| DMSDIMETHYL SULFOXIDE | P - 1001 | 0 | 1 |
| DMSDIMETHYL SULFOXIDE | S - 1002 | 0 | 1 |
| DMSDIMETHYL SULFOXIDE | V - 1003 | 0 | 1 |
| DMSDIMETHYL SULFOXIDE | S - 1004 | 0 | 1 |
| DMSDIMETHYL SULFOXIDE | A - 1005 | 0 | 1 |
| DMSDIMETHYL SULFOXIDE | Q - 1008 | 0 | 1 |
| GALD-GALACTOSE | G - 1012 | 0 | 1 |
| GALD-GALACTOSE | R - 1013 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|