|
|
|
|
|
|
|
| Information on 1v54_B_116 |
|
Loop code: 1v54_B_116 PDB: 1v54 Chain: B Type: AR beta-beta link |
Loop Start: 116 Loop Length: 21 Sec Struct Nt length: 5 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | LSFDSYMIPTSELKPGELRLLEVDNRVVLP |
| Sec Struct: | EEEEE-B--GGG--TT--TTT-BSS-EEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| FMEN-FORMYLMETHIONINE | L - 133 | 0 | 1 |
| FMEN-FORMYLMETHIONINE | L - 136 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|