|
|
|
|
|
|
|
| Information on 1kv7_A_314 |
|
Loop code: 1kv7_A_314 PDB: 1kv7 Chain: A Type: AR beta-beta link |
Loop Start: 314 Loop Length: 21 Sec Struct Nt length: 12 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | HPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSM |
| Sec Struct: | EEEEEEEEEEEE------S-----------TT-EEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CUCOPPER (II) ION | L - 353 | 1 | 0 |
| CUCOPPER (II) ION | M - 355 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|