|
|
|
|
|
|
|
| Information on 1pvc_1_125 |
|
Loop code: 1pvc_1_125 PDB: 1pvc Chain: 1 Type: AR beta-beta link |
Loop Start: 125 Loop Length: 11 Sec Struct Nt length: 18 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | FTYSRFDMEFTFVVTANFTNANNGHALNQVYQIMYI |
| Sec Struct: | EEEEEEEEEEEEEEEEEE-SS-S------EEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| SPHSPHINGOSINE | S - 128 | 1 | 0 |
| SPHSPHINGOSINE | F - 130 | 1 | 0 |
| SPHSPHINGOSINE | M - 132 | 1 | 0 |
| SPHSPHINGOSINE | F - 134 | 1 | 0 |
| SPHSPHINGOSINE | F - 136 | 1 | 0 |
| SPHSPHINGOSINE | I - 157 | 1 | 0 |
| SPHSPHINGOSINE | M - 158 | 1 | 0 |
| SPHSPHINGOSINE | Y - 159 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|