|
|
|
|
|
|
|
| Information on 1h30_A_420 |
|
Loop code: 1h30_A_420 PDB: 1h30 Chain: A Type: AR beta-beta link |
Loop Start: 420 Loop Length: 19 Sec Struct Nt length: 4 Sec Struct Ct length: 8 Structure geometry
|
| Sequence: | NLTVGGIPFHEKDLVQPINPRLDGCMRSWNW |
| Sec Struct: | EEEESS-SS-GGGSSS-------EEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | N - 438 | 0 | 1 |
| CACALCIUM ION | P - 439 | 0 | 1 |
| CACALCIUM ION | R - 440 | 0 | 1 |
| CACALCIUM ION | L - 441 | 0 | 1 |
| CACALCIUM ION | D - 442 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| SO2 - SO4 BINDING SITE FOR CHAIN A | K - 431 | 0 | 1 |
| CAA - CA BINDING SITE FOR CHAIN A | R - 440 | 0 | 1 |
| SO1 - SO4 BINDING SITE FOR CHAIN A | R - 446 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|