|
|
|
|
|
|
|
| Information on 1ire_B_144 |
|
Loop code: 1ire_B_144 PDB: 1ire Chain: B Type: HA beta-beta hairpin |
Loop Start: 144 Loop Length: 18 Sec Struct Nt length: 4 Sec Struct Ct length: 11 Structure geometry
|
| Sequence: | VVRFSTASPKGHARRARYVRGKTGTVVKHHGAY |
| Sec Struct: | EEEE-----SS-----GGGTT-EEEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CEAS-HYDROXY-CYSTEINE | R - 157 | 0 | 1 |
| COCOBALT (II) ION | R - 157 | 0 | 1 |
| CSD3-SULFINOALANINE | R - 157 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|