|
|
|
|
|
|
|
| Information on 1jj2_P_38 |
|
Loop code: 1jj2_P_38 PDB: 1jj2 Chain: P Type: HA beta-beta hairpin |
Loop Start: 38 Loop Length: 18 Sec Struct Nt length: 4 Sec Struct Ct length: 8 Structure geometry
|
| Sequence: | KVHLKIDPSVPNGRFHPRFDGQTGTVEGKQ |
| Sec Struct: | EEEE---TT--SS---GGGTT-EEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | N - 49 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|