|
|
|
|
|
|
|
| Information on 1aqf_E_108 |
|
Loop code: 1aqf_E_108 PDB: 1aqf Chain: E Type: EH beta-alpha |
Loop Start: 108 Loop Length: 16 Sec Struct Nt length: 5 Sec Struct Ct length: 11 Structure geometry
|
| Sequence: | AVALDTKGPEPGAAVDLPAVSEKDIQDLKFGV |
| Sec Struct: | EEEEE-------------SS-HHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PEQL-PHOSPHOLACTATE | D - 112 | 0 | 1 |
| MGMAGNESIUM ION | T - 113 | 0 | 1 |
| PEQL-PHOSPHOLACTATE | T - 113 | 0 | 1 |
| MGMAGNESIUM ION | K - 114 | 0 | 1 |
| PEQL-PHOSPHOLACTATE | K - 114 | 0 | 1 |
| MGMAGNESIUM ION | G - 115 | 0 | 1 |
| MGMAGNESIUM ION | P - 116 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|