|
|
|
|
|
|
|
| Information on 1om4_A_311 |
|
Loop code: 1om4_A_311 PDB: 1om4 Chain: A Type: EH beta-alpha |
Loop Start: 311 Loop Length: 25 Sec Struct Nt length: 4 Sec Struct Ct length: 18 Structure geometry
|
| Sequence: | VLTDTLHLKSTLETGCTEHICMGSIMLPTKDQLFPLAKEFLDQYYSS |
| Sec Struct: | EEEE-GGGG--S--S--SS---TT-S---HHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | L - 316 | 0 | 1 |
| GOLGLYCEROL | K - 319 | 0 | 1 |
| ZNZINC ION | T - 324 | 0 | 1 |
| ZNZINC ION | C - 326 | 0 | 1 |
| ZNZINC ION | T - 327 | 0 | 1 |
| ZNZINC ION | I - 330 | 0 | 1 |
| ZNZINC ION | C - 331 | 0 | 1 |
| ZNZINC ION | M - 332 | 0 | 1 |
| BH4(6R,1'R,2'S)-5,6,7,8 TETRAHYDROBIOPTERIN | G - 333 | 0 | 1 |
| ZNZINC ION | G - 333 | 0 | 1 |
| BH4(6R,1'R,2'S)-5,6,7,8 TETRAHYDROBIOPTERIN | S - 334 | 0 | 1 |
| BH4(6R,1'R,2'S)-5,6,7,8 TETRAHYDROBIOPTERIN | I - 335 | 0 | 1 |
| BH4(6R,1'R,2'S)-5,6,7,8 TETRAHYDROBIOPTERIN | M - 336 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|