|
|
|
|
|
|
|
| Information on 1itx_A_273 |
|
Loop code: 1itx_A_273 PDB: 1itx Chain: A Type: EH beta-alpha |
Loop Start: 273 Loop Length: 22 Sec Struct Nt length: 4 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | WINIMTYDFNGAWQKISAHNAPLNYDPAASA |
| Sec Struct: | EEEE----SS-TTSSB---SS-SS--HHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | N - 275 | 0 | 1 |
| GOLGLYCEROL | I - 276 | 0 | 1 |
| GOLGLYCEROL | M - 277 | 0 | 1 |
| GOLGLYCEROL | T - 278 | 0 | 1 |
| GOLGLYCEROL | Y - 279 | 0 | 1 |
| GOLGLYCEROL | D - 280 | 0 | 1 |
| GOLGLYCEROL | F - 281 | 0 | 1 |
| GOLGLYCEROL | W - 285 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|