|
|
|
|
|
|
|
| Information on 1q7e_A_367 |
|
Loop code: 1q7e_A_367 PDB: 1q7e Chain: A Type: EH beta-alpha |
Loop Start: 367 Loop Length: 21 Sec Struct Nt length: 6 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | GKYLTVGCPKFSAFTPDIKAAPLLGEHTAAVLQE |
| Sec Struct: | EEEEEE-----SS----------TTTTHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | Y - 369 | 1 | 0 |
| MSESELENOMETHIONINE | L - 370 | 1 | 0 |
| MSESELENOMETHIONINE | T - 371 | 0 | 1 |
| MSESELENOMETHIONINE | V - 372 | 0 | 1 |
| MSESELENOMETHIONINE | G - 373 | 0 | 1 |
| MSESELENOMETHIONINE | C - 374 | 0 | 1 |
| MSESELENOMETHIONINE | P - 375 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|