|
|
|
|
|
|
|
| Information on 1igw_B_314 |
|
Loop code: 1igw_B_314 PDB: 1igw Chain: B Type: EH beta-alpha |
Loop Start: 314 Loop Length: 11 Sec Struct Nt length: 5 Sec Struct Ct length: 14 Structure geometry
|
| Sequence: | LAYNCSPSFNWQKNLDDKTIASFQQQLSDM |
| Sec Struct: | EEEEE---TTSTTSS-HHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| HGMERCURY (II) ION | Y - 316 | 1 | 0 |
| HGMERCURY (II) ION | N - 317 | 0 | 1 |
| PYRPYRUVIC ACID | N - 317 | 0 | 1 |
| HGMERCURY (II) ION | C - 318 | 0 | 1 |
| HGMERCURY (II) ION | S - 319 | 0 | 1 |
| HGMERCURY (II) ION | P - 320 | 0 | 1 |
| HGMERCURY (II) ION | F - 336 | 1 | 0 |
| HGMERCURY (II) ION | Q - 337 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|