|
|
|
|
|
|
|
| Information on 1pii_*_375 |
|
Loop code: 1pii_*_375 PDB: 1pii Chain: * Type: HA beta-beta hairpin |
Loop Start: 375 Loop Length: 22 Sec Struct Nt length: 5 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | KYVLDNGQGGSGQRFDWSLLNGQSLGNVLLA |
| Sec Struct: | EEEEES-S--SS----GGGGTTS--TTEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PO4PHOSPHATE ION | D - 379 | 0 | 1 |
| PO4PHOSPHATE ION | N - 380 | 0 | 1 |
| PO4PHOSPHATE ION | G - 383 | 0 | 1 |
| PO4PHOSPHATE ION | G - 384 | 0 | 1 |
| PO4PHOSPHATE ION | S - 385 | 0 | 1 |
| PO4PHOSPHATE ION | G - 386 | 0 | 1 |
| PO4PHOSPHATE ION | Q - 387 | 0 | 1 |
| PO4PHOSPHATE ION | A - 405 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|