|
|
|
|
|
|
|
| Information on 1rvk_A_328 |
|
Loop code: 1rvk_A_328 PDB: 1rvk Chain: A Type: AR beta-beta link |
Loop Start: 328 Loop Length: 25 Sec Struct Nt length: 4 Sec Struct Ct length: 3 Structure geometry
|
| Sequence: | YERGLLHPFLEYDDGHDYLKSLSDPDRDGFVH |
| Sec Struct: | EEEE---TTS-GGG--TTBSS-S---TTSEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | E - 329 | 1 | 0 |
| MSESELENOMETHIONINE | R - 330 | 0 | 1 |
| MSESELENOMETHIONINE | L - 332 | 0 | 1 |
| MSESELENOMETHIONINE | L - 333 | 0 | 1 |
| MSESELENOMETHIONINE | H - 334 | 0 | 1 |
| MSESELENOMETHIONINE | L - 337 | 0 | 1 |
| MSESELENOMETHIONINE | D - 340 | 0 | 1 |
| MSESELENOMETHIONINE | D - 351 | 0 | 1 |
| MSESELENOMETHIONINE | P - 352 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|