|
|
|
|
|
|
|
| Information on 7req_B_71 |
|
Loop code: 7req_B_71 PDB: 7req Chain: B Type: AR beta-beta link |
Loop Start: 71 Loop Length: 35 Sec Struct Nt length: 2 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | DIVPMYRPKDAPKKLGYPGVAPFTRGTTVRNGDMDAWDVRALH |
| Sec Struct: | EE-S---GGGS-SS---TTSTT-TT-SS---S-S--SEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | G - 96 | 0 | 1 |
| GOLGLYCEROL | T - 97 | 0 | 1 |
| GOLGLYCEROL | T - 98 | 0 | 1 |
| GOLGLYCEROL | V - 99 | 0 | 1 |
| GOLGLYCEROL | R - 100 | 0 | 1 |
| GOLGLYCEROL | A - 106 | 0 | 1 |
| GOLGLYCEROL | W - 107 | 0 | 1 |
| GOLGLYCEROL | D - 108 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|