|
|
|
|
|
|
|
| Information on 1aco_*_414 |
|
Loop code: 1aco_*_414 PDB: 1aco Chain: * Type: AR beta-beta link |
Loop Start: 414 Loop Length: 22 Sec Struct Nt length: 3 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | GIVLANACGPCIGQWDRKDIKKGEKNTIVT |
| Sec Struct: | EEE--SS-GGGGT-B---SS-TT--EEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| FS4IRON/SULFUR CLUSTER | A - 420 | 0 | 1 |
| FS4IRON/SULFUR CLUSTER | C - 421 | 0 | 1 |
| FS4IRON/SULFUR CLUSTER | C - 424 | 0 | 1 |
| TRAACONITATE ION | C - 424 | 0 | 1 |
| FS4IRON/SULFUR CLUSTER | I - 425 | 0 | 1 |
| TRAACONITATE ION | I - 425 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|