|
|
|
|
|
|
|
| Information on 1h4p_A_169 |
|
Loop code: 1h4p_A_169 PDB: 1h4p Chain: A Type: EH beta-alpha |
Loop Start: 169 Loop Length: 21 Sec Struct Nt length: 8 Sec Struct Ct length: 17 Structure geometry
|
| Sequence: | KVWVDLHGAAGSQNGFDNSGLRDSYKFLEDSNLAVTINVLNYILKK |
| Sec Struct: | EEEEEEEE-TT-SS--GGGSSTT---TTSHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | H - 175 | 0 | 1 |
| GOLGLYCEROL | N - 186 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AC2 - GOL BINDING SITE FOR CHAIN A | H - 175 | 0 | 1 |
| AC2 - GOL BINDING SITE FOR CHAIN A | N - 186 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|