|
|
|
|
|
|
|
| Information on 1o58_A_187 |
|
Loop code: 1o58_A_187 PDB: 1o58 Chain: A Type: HA beta-beta hairpin |
Loop Start: 187 Loop Length: 34 Sec Struct Nt length: 7 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | KIVAVEPAKSPVLSGGQPGKHAIQGIGAGFVPKILDRSVIDEVITV |
| Sec Struct: | EEEEEEETTS-TTTT--------TTS--SS--TT--GGG--EEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PO4PHOSPHATE ION | G - 211 | 0 | 1 |
| PO4PHOSPHATE ION | I - 212 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|