|
|
|
|
|
|
|
| Information on 1s5a_A_86 |
|
Loop code: 1s5a_A_86 PDB: 1s5a Chain: A Type: HA beta-beta hairpin |
Loop Start: 86 Loop Length: 9 Sec Struct Nt length: 12 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | TVIAEFQCDGHVIETGLPYRQSYISVIETR |
| Sec Struct: | EEEEEEEEEEEETTT--B---EEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | T - 86 | 1 | 0 |
| GOLGLYCEROL | F - 91 | 1 | 0 |
| MSESELENOMETHIONINE | F - 91 | 1 | 0 |
| MSESELENOMETHIONINE | Q - 92 | 1 | 0 |
| ACTACETATE ION | C - 93 | 1 | 0 |
| ACTACETATE ION | Y - 104 | 0 | 1 |
| ACTACETATE ION | Q - 106 | 0 | 1 |
| ACTACETATE ION | Y - 108 | 1 | 0 |
| GOLGLYCEROL | Y - 108 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|