|
|
|
|
|
|
|
| Information on 1kll_A_7 |
|
Loop code: 1kll_A_7 PDB: 1kll Chain: A Type: AR beta-beta link |
Loop Start: 7 Loop Length: 22 Sec Struct Nt length: 6 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | LFAVVVEDAKSEFYRKGVEIPAEADSAPHTEAV |
| Sec Struct: | EEEEEE------TTT------TTGGG-SEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MC1,2-CIS-1-HYDROXY-2,7-DIAMINO-MITOSENE | L - 7 | 1 | 0 |
| MC1,2-CIS-1-HYDROXY-2,7-DIAMINO-MITOSENE | A - 9 | 1 | 0 |
| MSESELENOMETHIONINE | V - 10 | 1 | 0 |
| MC1,2-CIS-1-HYDROXY-2,7-DIAMINO-MITOSENE | V - 11 | 0 | 1 |
| MSESELENOMETHIONINE | V - 12 | 0 | 1 |
| MSESELENOMETHIONINE | E - 13 | 0 | 1 |
| MSESELENOMETHIONINE | D - 14 | 0 | 1 |
| MSESELENOMETHIONINE | A - 33 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|