|
|
|
|
|
|
|
| Information on 1kw3_B_112 |
|
Loop code: 1kw3_B_112 PDB: 1kw3 Chain: B Type: AR beta-beta link |
Loop Start: 112 Loop Length: 27 Sec Struct Nt length: 6 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | PLEIYYGPAEIFHEPFLPSAPVSGFVTGDQGIGHFVRC |
| Sec Struct: | EEEEEE---B-TTS----SSS---B--GGG-S-EEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MPD2-METHYL-2,4-PENTANEDIOL | P - 126 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | F - 127 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | L - 128 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | P - 129 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | S - 134 | 0 | 1 |
| FE2FE (II) ION | H - 145 | 0 | 1 |
| FE2FE (II) ION | V - 147 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|