|
|
|
|
|
|
|
| Information on 1njk_A_49 |
|
Loop code: 1njk_A_49 PDB: 1njk Chain: A Type: AR beta-beta link |
Loop Start: 49 Loop Length: 8 Sec Struct Nt length: 12 Sec Struct Ct length: 12 Structure geometry
|
| Sequence: | IAFVVVNININYRRPAVLSDLLTITSQLQQLN |
| Sec Struct: | EEEEEEEEEEEE-S---TT-EEEEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | I - 49 | 1 | 0 |
| MSESELENOMETHIONINE | A - 50 | 1 | 0 |
| MSESELENOMETHIONINE | F - 51 | 1 | 0 |
| IODIODIDE ION | R - 61 | 0 | 1 |
| MSESELENOMETHIONINE | I - 72 | 1 | 0 |
| MSESELENOMETHIONINE | T - 73 | 1 | 0 |
| MSESELENOMETHIONINE | S - 74 | 1 | 0 |
| MSESELENOMETHIONINE | Q - 75 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|