|
|
|
|
|
|
|
| Information on 1r51_A_8 |
|
Loop code: 1r51_A_8 PDB: 1r51 Chain: A Type: HA beta-beta hairpin |
Loop Start: 8 Loop Length: 6 Sec Struct Nt length: 13 Sec Struct Ct length: 14 Structure geometry
|
| Sequence: | YGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEG |
| Sec Struct: | EEEEEEEEEEEEE-TTT--EEEEEEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| FCYFREE CYSTEINE | K - 10 | 1 | 0 |
| FCYFREE CYSTEINE | D - 11 | 1 | 0 |
| FCYFREE CYSTEINE | C - 35 | 1 | 0 |
| FCYFREE CYSTEINE | V - 36 | 1 | 0 |
| FCYFREE CYSTEINE | L - 37 | 1 | 0 |
| Associated ArchDB95 Subclass to 1r51_A_8 |
| For any comment or web-related incidence, send an email to the webmaster. |
|