|
|
|
|
|
|
|
| Information on 1k2e_A_52 |
|
Loop code: 1k2e_A_52 PDB: 1k2e Chain: A Type: AR beta-beta link |
Loop Start: 52 Loop Length: 19 Sec Struct Nt length: 5 Sec Struct Ct length: 8 Structure geometry
|
| Sequence: | IVVEPIGFTYGIIDENAVERPMPLVILEEVVK |
| Sec Struct: | EEEEE-------BSSS-B-----SEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CRYPROPANE-1,2,3-TRIOL | E - 80 | 1 | 0 |
| CRYPROPANE-1,2,3-TRIOL | V - 82 | 1 | 0 |
| NINICKEL (II) ION | V - 82 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|