|
|
|
|
|
|
|
| Information on 1iyb_A_168 |
|
Loop code: 1iyb_A_168 PDB: 1iyb Chain: A Type: HA beta-beta hairpin |
Loop Start: 168 Loop Length: 19 Sec Struct Nt length: 11 Sec Struct Ct length: 3 Structure geometry
|
| Sequence: | SQLYQIYICVDGSGSNLIECPIFPRGKCGSSIE |
| Sec Struct: | EEEEEEEEEEETTSSSB---S--------SEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| 5GPGUANOSINE-5'-MONOPHOSPHATE | Y - 171 | 1 | 0 |
| 5GPGUANOSINE-5'-MONOPHOSPHATE | Q - 172 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|