|
|
|
|
|
|
|
| Information on 1h8u_A_66 |
|
Loop code: 1h8u_A_66 PDB: 1h8u Chain: A Type: AR beta-beta link |
Loop Start: 66 Loop Length: 22 Sec Struct Nt length: 4 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | RFQWVDGSRWNFAYWAAHQPWSRGGHCVALC |
| Sec Struct: | EEEETT--------B-SSS--TTS-SEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | N - 76 | 0 | 1 |
| GOLGLYCEROL | F - 77 | 0 | 1 |
| GOLGLYCEROL | A - 78 | 0 | 1 |
| GOLGLYCEROL | Y - 79 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|