|
|
|
|
|
|
|
| Information on 1daa_A_85 |
|
Loop code: 1daa_A_85 PDB: 1daa Chain: A Type: HA beta-beta hairpin |
Loop Start: 85 Loop Length: 17 Sec Struct Nt length: 8 Sec Struct Ct length: 8 Structure geometry
|
| Sequence: | GHIYFQVTRGTSPRAHQFPENTVKPVIIGYTKE |
| Sec Struct: | EEEEEEEE--B-SS-SS--SS----EEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PLPPYRIDOXAL-5'-PHOSPHATE | H - 100 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|