|
|
|
|
|
|
|
| Information on 1l0l_E_163 |
|
Loop code: 1l0l_E_163 PDB: 1l0l Chain: E Type: AR beta-beta link |
Loop Start: 163 Loop Length: 27 Sec Struct Nt length: 2 Sec Struct Ct length: 2 Structure geometry
|
| Sequence: | SHYDASGRIRKGPAPLNLEVPSYEFTSDDMV |
| Sec Struct: | EE--SS----SSS--S---------SSSSEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| FESFE2/S2 (INORGANIC) CLUSTER | S - 163 | 0 | 1 |
| FESFE2/S2 (INORGANIC) CLUSTER | Y - 165 | 0 | 1 |
| FESFE2/S2 (INORGANIC) CLUSTER | P - 175 | 0 | 1 |
| FESFE2/S2 (INORGANIC) CLUSTER | A - 176 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|