|
|
|
|
|
|
|
| Information on 1fep_A_89 |
|
Loop code: 1fep_A_89 PDB: 1fep Chain: A Type: AR beta-beta link |
Loop Start: 89 Loop Length: 29 Sec Struct Nt length: 2 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | KPVSSRNSVRQGWRGERDTRGDTSWVPPEIERIEVLR |
| Sec Struct: | EE--GGGGS---TTS---S--STTSS-----EEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | P - 90 | 0 | 1 |
| MSESELENOMETHIONINE | S - 92 | 0 | 1 |
| MSESELENOMETHIONINE | N - 95 | 0 | 1 |
| MSESELENOMETHIONINE | S - 96 | 0 | 1 |
| MSESELENOMETHIONINE | V - 114 | 0 | 1 |
| MSESELENOMETHIONINE | P - 115 | 0 | 1 |
| MSESELENOMETHIONINE | P - 116 | 0 | 1 |
| MSESELENOMETHIONINE | E - 117 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|