|
|
|
|
|
|
|
| Information on 1fep_A_360 |
|
Loop code: 1fep_A_360 PDB: 1fep Chain: A Type: HA beta-beta hairpin |
Loop Start: 360 Loop Length: 17 Sec Struct Nt length: 13 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | NQTLTLGTEWNQQRKDLSSNTQADRSPYSKAEIFSLFAEN |
| Sec Struct: | EEEEEEEEEEEEE-----------------EEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | N - 360 | 1 | 0 |
| MSESELENOMETHIONINE | Q - 361 | 1 | 0 |
| MSESELENOMETHIONINE | T - 362 | 1 | 0 |
| MSESELENOMETHIONINE | E - 368 | 1 | 0 |
| MSESELENOMETHIONINE | W - 369 | 1 | 0 |
| MSESELENOMETHIONINE | N - 370 | 1 | 0 |
| MSESELENOMETHIONINE | Q - 371 | 0 | 1 |
| MSESELENOMETHIONINE | Q - 372 | 0 | 1 |
| MSESELENOMETHIONINE | R - 373 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|