|
|
|
|
|
|
|
| Information on 1r6t_A_156 |
|
Loop code: 1r6t_A_156 PDB: 1r6t Chain: A Type: EH beta-alpha |
Loop Start: 156 Loop Length: 12 Sec Struct Nt length: 5 Sec Struct Ct length: 14 Structure geometry
|
| Sequence: | FYLYTGRGPSSEAHVGHLIPFIFTKWLQDVF |
| Sec Struct: | EEEEE-----TT--GGGHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| TYMTRYPTOPHANYL-5'AMP | Y - 159 | 0 | 1 |
| TYMTRYPTOPHANYL-5'AMP | T - 160 | 0 | 1 |
| MSESELENOMETHIONINE | G - 161 | 0 | 1 |
| TYMTRYPTOPHANYL-5'AMP | G - 161 | 0 | 1 |
| MSESELENOMETHIONINE | R - 162 | 0 | 1 |
| TYMTRYPTOPHANYL-5'AMP | R - 162 | 0 | 1 |
| MSESELENOMETHIONINE | G - 163 | 0 | 1 |
| TYMTRYPTOPHANYL-5'AMP | G - 163 | 0 | 1 |
| MSESELENOMETHIONINE | P - 164 | 0 | 1 |
| TYMTRYPTOPHANYL-5'AMP | P - 164 | 0 | 1 |
| MSESELENOMETHIONINE | S - 165 | 0 | 1 |
| MSESELENOMETHIONINE | S - 166 | 0 | 1 |
| MSESELENOMETHIONINE | E - 167 | 0 | 1 |
| MSESELENOMETHIONINE | A - 168 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|