|
|
|
|
|
|
|
| Information on 1hiz_A_261 |
|
Loop code: 1hiz_A_261 PDB: 1hiz Chain: A Type: EH beta-alpha |
Loop Start: 261 Loop Length: 17 Sec Struct Nt length: 9 Sec Struct Ct length: 20 Structure geometry
|
| Sequence: | DNQITELDVSMYGWPPRAYPTYDAIPKQKFLDQAARYDRLFKLYEK |
| Sec Struct: | EEEEEEEEE-SS-SS---BSSGGGS-HHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GLCGLUCOSE | E - 266 | 1 | 0 |
| GLCGLUCOSE | G - 273 | 0 | 1 |
| GLCGLUCOSE | W - 274 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| GL1 - GLC BINDING SITE FOR RESIDUE A1381 | E - 266 | 1 | 0 |
| GL2 - GLC BINDING SITE FOR RESIDUE A1382 | W - 274 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|