|
|
|
|
|
|
|
| Information on 1h3g_A_109 |
|
Loop code: 1h3g_A_109 PDB: 1h3g Chain: A Type: EH beta-alpha |
Loop Start: 109 Loop Length: 33 Sec Struct Nt length: 3 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | IYQIPDRFANGDPSNDNVAGREQADRRHGGGRHGGDIRGTID |
| Sec Struct: | EEE--TTT--S-GGGSS--------TTSTTS-----HHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | Q - 111 | 0 | 1 |
| MSESELENOMETHIONINE | Q - 111 | 0 | 1 |
| CACALCIUM ION | I - 112 | 0 | 1 |
| MSESELENOMETHIONINE | I - 112 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|