|
|
|
|
|
|
|
| Information on 1p2z_A_692 |
|
Loop code: 1p2z_A_692 PDB: 1p2z Chain: A Type: EH beta-alpha |
Loop Start: 692 Loop Length: 21 Sec Struct Nt length: 8 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | GWAFTRLKTKETPSLGSGYDPYYTYSGSIPYLD |
| Sec Struct: | EEEEEEEEGGG----SSS--TT----S--HHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CITCITRIC ACID | K - 699 | 0 | 1 |
| CITCITRIC ACID | K - 701 | 0 | 1 |
| CITCITRIC ACID | E - 702 | 0 | 1 |
| CITCITRIC ACID | Y - 716 | 0 | 1 |
| CITCITRIC ACID | S - 717 | 0 | 1 |
| CITCITRIC ACID | G - 718 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|