|
|
|
|
|
|
|
| Information on 1v3e_A_331 |
|
Loop code: 1v3e_A_331 PDB: 1v3e Chain: A Type: EH beta-alpha |
Loop Start: 331 Loop Length: 19 Sec Struct Nt length: 10 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | KIIFLGYGGLEHPINENVICNTTGCPGKTQRDCNQA |
| Sec Struct: | EEEEEEEEEESS------S---TT-TT--HHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ZMRZANAMIVIR | Y - 337 | 1 | 0 |
| NAGN-ACETYL-D-GLUCOSAMINE | N - 351 | 0 | 1 |
| NAGN-ACETYL-D-GLUCOSAMINE | T - 352 | 0 | 1 |
| NAGN-ACETYL-D-GLUCOSAMINE | T - 353 | 0 | 1 |
| NAGN-ACETYL-D-GLUCOSAMINE | G - 354 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|