|
|
|
|
|
|
|
| Information on 1goi_A_292 |
|
Loop code: 1goi_A_292 PDB: 1goi Chain: A Type: EH beta-alpha |
Loop Start: 292 Loop Length: 31 Sec Struct Nt length: 6 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | YGRAFKGVSGGNGGQYSSHSTPGEDPYPSTDYWLVGCEECVRD |
| Sec Struct: | EEEEEES--SSSTTTT--------SS-SSS---STT-HHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | Y - 292 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|