|
|
|
|
|
|
|
| Information on 1ur1_A_100 |
|
Loop code: 1ur1_A_100 PDB: 1ur1 Chain: A Type: EH beta-alpha |
Loop Start: 100 Loop Length: 19 Sec Struct Nt length: 8 Sec Struct Ct length: 18 Structure geometry
|
| Sequence: | HMVGHTLVWHSQIHDEVFKNADGSYISKAALQKKMEEHITTLAGR |
| Sec Struct: | EEEEEEEE-SSSS-GGGTB-TTS-B--HHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | M - 101 | 1 | 0 |
| XYSXYLOPYRANOSE | H - 104 | 1 | 0 |
| XYSXYLOPYRANOSE | T - 105 | 1 | 0 |
| XYPBETA-D-XYLOPYRANOSE | W - 108 | 0 | 1 |
| XYSXYLOPYRANOSE | W - 108 | 0 | 1 |
| XYPBETA-D-XYLOPYRANOSE | Q - 111 | 0 | 1 |
| XYSXYLOPYRANOSE | Q - 111 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AC2 - XYP BINDING SITE FOR CHAIN A | Q - 111 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|