|
|
|
|
|
|
|
| Information on 1qnr_A_199 |
|
Loop code: 1qnr_A_199 PDB: 1qnr Chain: A Type: EH beta-alpha |
Loop Start: 199 Loop Length: 24 Sec Struct Nt length: 3 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | LVTLGDEGLGLSTGDGAYPYTYGEGTDFAKNV |
| Sec Struct: | EEE--------TTS---GGGSSSSS--HHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MABMANNOBIOSE | E - 205 | 0 | 1 |
| MABMANNOBIOSE | L - 207 | 0 | 1 |
| NAGN-ACETYL-D-GLUCOSAMINE | D - 213 | 0 | 1 |
| MABMANNOBIOSE | Y - 216 | 0 | 1 |
| MABMANNOBIOSE | E - 222 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|