|
|
|
|
|
|
|
| Information on 1uhv_A_224 |
|
Loop code: 1uhv_A_224 PDB: 1uhv Chain: A Type: EH beta-alpha |
Loop Start: 224 Loop Length: 18 Sec Struct Nt length: 7 Sec Struct Ct length: 16 Structure geometry
|
| Sequence: | FVSRHAYTSKQGEYTPHLIYQEIMPSEYMLNEFKTVREIIK |
| Sec Struct: | EEEEEEE-B------SS-----B--HHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| DFX1,2-DEOXY-2-FLUORO-XYLOPYRANOSE | H - 228 | 1 | 0 |
| DFX1,2-DEOXY-2-FLUORO-XYLOPYRANOSE | Y - 230 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|