|
|
|
|
|
|
|
| Information on 1ug6_A_298 |
|
Loop code: 1ug6_A_298 PDB: 1ug6 Chain: A Type: EH beta-alpha |
Loop Start: 298 Loop Length: 15 Sec Struct Nt length: 3 Sec Struct Ct length: 14 Structure geometry
|
| Sequence: | VRYLPPEGPATAMGWEVYPEGLYHLLKRLGRE |
| Sec Struct: | EEE---SS-B-TT--B--HHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | M - 310 | 0 | 1 |
| GOLGLYCEROL | W - 312 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|