|
|
|
|
|
|
|
| Information on 1vhq_A_38 |
|
Loop code: 1vhq_A_38 PDB: 1vhq Chain: A Type: EH beta-alpha |
Loop Start: 38 Loop Length: 21 Sec Struct Nt length: 6 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | QAVCFAPDKQQVDVINHLTGEATETRNVLIEA |
| Sec Struct: | EEEEEE-SSB-S----TTT-------BHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | Q - 38 | 1 | 0 |
| MSESELENOMETHIONINE | V - 51 | 0 | 1 |
| MSESELENOMETHIONINE | I - 52 | 0 | 1 |
| MSESELENOMETHIONINE | N - 53 | 0 | 1 |
| MSESELENOMETHIONINE | H - 54 | 0 | 1 |
| MSESELENOMETHIONINE | E - 58 | 0 | 1 |
| MSESELENOMETHIONINE | A - 59 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|