|
|
|
|
|
|
|
| Information on 1ado_A_227 |
|
Loop code: 1ado_A_227 PDB: 1ado Chain: A Type: EH beta-alpha |
Loop Start: 227 Loop Length: 16 Sec Struct Nt length: 2 Sec Struct Ct length: 15 Structure geometry
|
| Sequence: | LLKPNMVTPGHACTQKYSHEEIAMATVTALRRT |
| Sec Struct: | EE--------TT--S---HHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| 13P1,3-DIHYDROXYACETONEPHOSPHATE | K - 229 | 0 | 1 |
| Associated ArchDB95 Subclass to 1ado_A_227 |
| Associated ArchDB-EC Subclass to 1ado_A_227 |
| For any comment or web-related incidence, send an email to the webmaster. |
|