|
|
|
|
|
|
|
| Information on 1kek_A_1063 |
|
Loop code: 1kek_A_1063 PDB: 1kek Chain: A Type: EH beta-alpha |
Loop Start: 1063 Loop Length: 14 Sec Struct Nt length: 6 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | SLVIAYATCINQGLRKGMGKSQDVMNTAVK |
| Sec Struct: | EEEEEE---GGG-BTT-GGGHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | S - 1063 | 1 | 0 |
| FS4IRON/SULFUR CLUSTER | T - 1070 | 0 | 1 |
| FS4IRON/SULFUR CLUSTER | C - 1071 | 0 | 1 |
| FS4IRON/SULFUR CLUSTER | I - 1072 | 0 | 1 |
| FS4IRON/SULFUR CLUSTER | N - 1073 | 0 | 1 |
| FS4IRON/SULFUR CLUSTER | M - 1080 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|