|
|
|
|
|
|
|
| Information on 1okg_A_56 |
|
Loop code: 1okg_A_56 PDB: 1okg Chain: A Type: EH beta-alpha |
Loop Start: 56 Loop Length: 23 Sec Struct Nt length: 2 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | IRADVDTNLSKLVPTSTARHPLPPAEFIDW |
| Sec Struct: | EE--TTTTS----TT---SS-----HHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | I - 56 | 0 | 1 |
| MSESELENOMETHIONINE | V - 60 | 0 | 1 |
| MSESELENOMETHIONINE | N - 63 | 0 | 1 |
| MSESELENOMETHIONINE | L - 64 | 0 | 1 |
| MSESELENOMETHIONINE | S - 65 | 0 | 1 |
| CSSS-MERCAPTOCYSTEINE | R - 74 | 0 | 1 |
| SO3SULFITE ION | R - 74 | 0 | 1 |
| SO3SULFITE ION | H - 75 | 0 | 1 |
| CACALCIUM ION | L - 77 | 0 | 1 |
| CSRS-ARSONOCYSTEINE | L - 77 | 0 | 1 |
| MSESELENOMETHIONINE | L - 77 | 0 | 1 |
| CACALCIUM ION | P - 78 | 0 | 1 |
| CSRS-ARSONOCYSTEINE | P - 78 | 0 | 1 |
| MSESELENOMETHIONINE | P - 78 | 0 | 1 |
| CACALCIUM ION | P - 79 | 0 | 1 |
| CSRS-ARSONOCYSTEINE | P - 79 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AC2 - SO3 BINDING SITE FOR CHAIN A | R - 74 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|