|
|
|
|
|
|
|
| Information on 1knv_A_147 |
|
Loop code: 1knv_A_147 PDB: 1knv Chain: A Type: EH beta-alpha |
Loop Start: 147 Loop Length: 17 Sec Struct Nt length: 5 Sec Struct Ct length: 8 Structure geometry
|
| Sequence: | LLIIRQKDLIKSEYNLPINKLTHENIDVAL |
| Sec Struct: | EEEEE-GGG--GGGGS---S--HHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ACTACETATE ION | T - 168 | 0 | 1 |
| ACTACETATE ION | H - 169 | 0 | 1 |
| ACTACETATE ION | E - 170 | 1 | 0 |
| ACTACETATE ION | I - 172 | 1 | 0 |
| ACTACETATE ION | D - 173 | 1 | 0 |
| ACTACETATE ION | L - 176 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|