|
|
|
|
|
|
|
| Information on 1nt4_A_114 |
|
Loop code: 1nt4_A_114 PDB: 1nt4 Chain: A Type: EH beta-alpha |
Loop Start: 114 Loop Length: 21 Sec Struct Nt length: 2 Sec Struct Ct length: 16 Structure geometry
|
| Sequence: | VHHQEKMGTMDPTFNPVITDDSAAFSEQAVAAMEKELSK |
| Sec Struct: | EE--S--SS--TTT--------SHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| G1PALPHA-D-GLUCOSE-1-PHOSPHATE | M - 123 | 0 | 1 |
| G1PALPHA-D-GLUCOSE-1-PHOSPHATE | F - 127 | 0 | 1 |
| G1PALPHA-D-GLUCOSE-1-PHOSPHATE | P - 129 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|