|
|
|
|
|
|
|
| Information on 1vi9_A_32 |
|
Loop code: 1vi9_A_32 PDB: 1vi9 Chain: A Type: EH beta-alpha |
Loop Start: 32 Loop Length: 17 Sec Struct Nt length: 6 Sec Struct Ct length: 13 Structure geometry
|
| Sequence: | NVWPLNTVQFSNHTQYGKWTGVPPSHLTEIVQGIAA |
| Sec Struct: | EEEEEES--BSS-GGGS------HHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | N - 32 | 1 | 0 |
| MSESELENOMETHIONINE | V - 33 | 1 | 0 |
| MSESELENOMETHIONINE | N - 37 | 0 | 1 |
| CSD3-SULFINOALANINE | T - 38 | 0 | 1 |
| MSESELENOMETHIONINE | T - 38 | 0 | 1 |
| CSD3-SULFINOALANINE | V - 39 | 0 | 1 |
| MSESELENOMETHIONINE | V - 39 | 0 | 1 |
| CSD3-SULFINOALANINE | Q - 40 | 0 | 1 |
| MSESELENOMETHIONINE | Q - 40 | 0 | 1 |
| CSD3-SULFINOALANINE | F - 41 | 0 | 1 |
| CSD3-SULFINOALANINE | T - 51 | 0 | 1 |
| CSD3-SULFINOALANINE | G - 52 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|